HYI Antibody (H00081888-D01P)(0.1mg)

Catalog number: H00081888-D01P
Price: Ask price from support chat or by Email
Product name: HYI Antibody (H00081888-D01P)(0.1mg)

Applications

ELISA, WB
Uses: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions: Western Blot 1:500, ELISA

Background

Details

Immunogen: HYI (AAH19041.1, 1 a.a. ~ 174 a.a) full-length human protein.
Epitope: MGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVLAQEDLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGHVQVAQVPGRGEPSSPGELNFPYLFQLLEDEGYKGFVG

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging

Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Preservative: No Preservative
Limitations: This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.

Publications

Species

Human
Reactivity: Human..
*Note not all species have been tested for reactivity. Only those species listed have been tested. We cannot make any guarantees about additional reactivities or cross reactivities beyond those that have been tested. This antibody may or may not react with other species.

Summary

Labosample Reward Points:
  • Review this product for a reward and claim prizes ()
  • 100 points for each review and 100 for an image
  • We value both positive and negative feedback!
  • Reviews can be done at
(image) Labosample’ Quality Guarantee
We stand behind our products 100%. If you cannot get a product to work in an application or species stated on our datasheet, our technical service team will troubleshoot with you to get it to work. If a product still does not work after troubleshooting, you can receive a free of charge replacement product or a full refund. Labosample’ Quality Guarantee covers 100% of the products we carry, including those that we distribute for Abnova. No hassles, no nonsense. It is that simple!

+ Innovator’s Reward™
Our Innovator’s Rewardâ„¢ program is designed to support your innovative research with minimal financial risk to you. Should you decide to use one of our products in an application or species for which it has not been tested, Labosample will provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. Simply email [email protected] to apply for your award. We will send you a form for you to submit a summary of your research and report your experimental results, after which your award will be given. Your innovation can help us to accelerate bioscience research. After all, we’re making your success our goal.

= 100% Support and Peace of Mind


Summary:

Teste

ELISA, WB
Uses: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions: Western Blot 1:500, ELISA