BRD3 Antibody (H00008019-M01)(0.1mg)

Catalog number: H00008019-M01
Price: Ask price from support chat or by Email
Product name: BRD3 Antibody (H00008019-M01)(0.1mg)

Applications

WB, IHC-P, ELISA
Uses: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Dilutions: ELISA, Immunohistochemistry-Paraffin, Western Blot 1:500

Background

The bromodomain is a conserved 110 amino acid motif which specifically interacts with acetyl lysines, at least in the context of short histone H3 and H4 peptides. Although bromodomains have now been found in more than 40 different proteins, the function of this motif is poorly understood. The association of two N terminal bromodomains with a C terminal extraterminal (ET) domain defines the Fsh/Brd subgroup, which includes members in many species. In vertebrates, four members of the Fsh/Brd subgroup have now been identified: Brd2/RING3/fsrg1, Brd3/ORFX/fsrg2, Brd4/HUNK1/MCAP, and Brd5/BRDT. The Brd3/ORFX gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein is not known.

Details

Immunogen: BRD3 (AAH32124, 418 a.a. ~ 556 a.a) partial recombinant protein with GST tag.
Epitope: EPVEAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRDHFLTCGV
Clone: 6E7
Isotype: IgG1 Kappa
Localization: Nuclear

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging

Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer: Phosphate buffered saline, pH 7.2
Preservative: No Preservative
Limitations: This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.

Publications

Species

Human
Reactivity: Human. Other species not tested..
*Note not all species have been tested for reactivity. Only those species listed have been tested. We cannot make any guarantees about additional reactivities or cross reactivities beyond those that have been tested. This antibody may or may not react with other species.

Summary

Labosample Reward Points:
  • Review this product for a reward and claim prizes ()
  • 100 points for each review and 100 for an image
  • We value both positive and negative feedback!
  • Reviews can be done at
(image) Labosample’ Quality Guarantee
We stand behind our products 100%. If you cannot get a product to work in an application or species stated on our datasheet, our technical service team will troubleshoot with you to get it to work. If a product still does not work after troubleshooting, you can receive a free of charge replacement product or a full refund. Labosample’ Quality Guarantee covers 100% of the products we carry, including those that we distribute for Abnova. No hassles, no nonsense. It is that simple!

+ Innovator’s Reward™
Our Innovator’s Rewardâ„¢ program is designed to support your innovative research with minimal financial risk to you. Should you decide to use one of our products in an application or species for which it has not been tested, Labosample will provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. Simply email [email protected] to apply for your award. We will send you a form for you to submit a summary of your research and report your experimental results, after which your award will be given. Your innovation can help us to accelerate bioscience research. After all, we’re making your success our goal.

= 100% Support and Peace of Mind


Summary:

Teste

WB, IHC-P, ELISA
Uses: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Dilutions: ELISA, Immunohistochemistry-Paraffin, Western Blot 1:500