RPL32 Antibody (H00006161-A01)(0.05ml)

Catalog number: H00006161-A01
Price: Ask price from support chat or by Email
Product name: RPL32 Antibody (H00006161-A01)(0.05ml)

Applications

WB, ELISA
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera
Dilutions: ELISA, Western Blot 1:500

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding the same protein have been observed for this gene.

Details

Immunogen: RPL32 (NP_000985, 33 a.a. ~ 133 a.a) partial recombinant protein with GST tag.
Epitope: RNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSE*

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging

Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer: This antibody is in antisera with 50% glycerol and the concentration is unavailable.
Preservative: No Preservative
Limitations: This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.

Publications

Species

Human
Reactivity: Human. Other species not tested..
*Note not all species have been tested for reactivity. Only those species listed have been tested. We cannot make any guarantees about additional reactivities or cross reactivities beyond those that have been tested. This antibody may or may not react with other species.

Summary

Labosample Reward Points:
  • Review this product for a reward and claim prizes ()
  • 100 points for each review and 100 for an image
  • We value both positive and negative feedback!
  • Reviews can be done at
(image) Labosample’ Quality Guarantee
We stand behind our products 100%. If you cannot get a product to work in an application or species stated on our datasheet, our technical service team will troubleshoot with you to get it to work. If a product still does not work after troubleshooting, you can receive a free of charge replacement product or a full refund. Labosample’ Quality Guarantee covers 100% of the products we carry, including those that we distribute for Abnova. No hassles, no nonsense. It is that simple!

+ Innovator’s Reward™
Our Innovator’s Rewardâ„¢ program is designed to support your innovative research with minimal financial risk to you. Should you decide to use one of our products in an application or species for which it has not been tested, Labosample will provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. Simply email [email protected] to apply for your award. We will send you a form for you to submit a summary of your research and report your experimental results, after which your award will be given. Your innovation can help us to accelerate bioscience research. After all, we’re making your success our goal.

= 100% Support and Peace of Mind


Summary:

Teste

WB, ELISA
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera
Dilutions: ELISA, Western Blot 1:500