Bone marrow stromal cell antigen 1 Antibody (H00000683-M08)(0.1mg)

Catalog number: H00000683-M08
Price: Ask price from support chat or by Email
Product name: Bone marrow stromal cell antigen 1 Antibody (H00000683-M08)(0.1mg)

Applications

WB, ELISA
Uses: This antibody is useful for ELISA and Western Blot.
Dilutions: ELISA, Western Blot 1:500

Background

Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population. [provided by RefSeq]

Details

Immunogen: BST1 (AAH12095, 34 a.a. ~ 319 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope: WRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAA
Clone: 4C2
Isotype: IgG2a Kappa

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging

Storage: Store at -20C. Avoid freeze-thaw cycles.
Buffer: In 1x PBS, pH 7.2
Preservative: No Preservative
Limitations: This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.

Publications

Species

Human
Reactivity: Human.
*Note not all species have been tested for reactivity. Only those species listed have been tested. We cannot make any guarantees about additional reactivities or cross reactivities beyond those that have been tested. This antibody may or may not react with other species.

Summary

Labosample Reward Points:
  • Review this product for a reward and claim prizes ()
  • 100 points for each review and 100 for an image
  • We value both positive and negative feedback!
  • Reviews can be done at
(image) Labosample’ Quality Guarantee
We stand behind our products 100%. If you cannot get a product to work in an application or species stated on our datasheet, our technical service team will troubleshoot with you to get it to work. If a product still does not work after troubleshooting, you can receive a free of charge replacement product or a full refund. Labosample’ Quality Guarantee covers 100% of the products we carry, including those that we distribute for Abnova. No hassles, no nonsense. It is that simple!

+ Innovator’s Reward™
Our Innovator’s Rewardâ„¢ program is designed to support your innovative research with minimal financial risk to you. Should you decide to use one of our products in an application or species for which it has not been tested, Labosample will provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. Simply email [email protected] to apply for your award. We will send you a form for you to submit a summary of your research and report your experimental results, after which your award will be given. Your innovation can help us to accelerate bioscience research. After all, we’re making your success our goal.

= 100% Support and Peace of Mind


Summary:

Teste

WB, ELISA
Uses: This antibody is useful for ELISA and Western Blot.
Dilutions: ELISA, Western Blot 1:500